<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
33IND434 33IND434 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, K70KR, M184V, T215TNSY K219Q K101KPQT, K103N A98AG, P225PH E28EA, V35T, E36EAD, T39DE, S48ST, V60I, D121Y, K122E, S162A, K173AT, Q174K, D177E, G196GE, T200A, E203EV, Q207D, R211K, L228LH, V245Q I135ILPT
>33IND434| codons 6-255
ETVPVKLKPGMDGPKVKQWPLTAEKIKALTDICEELEKEGKITKIGPENPYNTPIFAIKK
KNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLTKNKSVTVLDVGDAYFSVPLYEDFR
KYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVIYQYVD
DLYVGSDLEIEQHRAKIVELRDHLLKWGFYTPDQKHQKEHPFHWMGYELHPDKWTVQPIQ
LPEKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010