<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
32IND433 32IND433 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151QKLM, M184V F116Y, K219Q K103N   V35T, T39E, S48T, V60I, K122E, D123NS, I135T, E169EA, K173A, D177E, I178IM, T200A, I202IV, Q207AP, L210LS, R211K, D218E, V245Q S105SL, V111VIM
>32IND433| codons 5-254
IETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFAIK
KKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKLVTVLDMGDAYYSVPLDESF
RKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILAPFRAQNPEMVIYQYV
DDLYVGSDLEIGQHRAKVEELRPHLSKWGFTTPEQKHQKEPPFLWMGYELHPDKWTVQPI
QLPEKDSWTV

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010