<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
23IND43 23IND43 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E Y188L   E28K, K32E, V35T, E36A, T39E, S48T, V60I, I94L, K122E, D123N, K173T, D177E, V189I, T200A, Q207E, H208Y, L228H, V245Q  
>23IND43| codons 6-249
ETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICEELEKEGKITKIGPENPYNTPIFAIKK
KNSTRWRKLVDFRELNKRTQDFWEVQLGLPHPAGLKKKKSVTVLDVGDAYFSVPLDENFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVIYQYVD
DLLIGSDLEIGQHRAKIEELREYLLRWGFYTPDEKHQKEPPFHWMGYELHPDKWTVQPIQ
LPEK

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010