<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
15IND427 15IND427 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, T39N, S48T, V60I, D121Y, K122E, I135IT, A158S, S162A, T165I, K173T, D177E, T200A, Q207E, R211K, L228LR, V245E  
>15IND427| codons 3-255
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKITKIGPENPYNTPIFA
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLYE
DFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQASMIKILEPFRTQNPEIVIYQ
YMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFRWMGYELHPDKWTVQ
PIELPEKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010