<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14IND426 14IND426 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 152

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, V75T, Q151M, M184V   Y188L   V35T, T39N, S48T, V60I, S68G, D121Y, K122E, D123E, I142V, K173A, D177E, V179I, V189I, T200A, I202V, Q207G, R211K, F214L, L228Q, V245Q I37M
>14IND426| codons 8-255
VPVKLKPGMDGPKVKQWPLTEEKIKALTEMCNEMEKEGKITKIGPENPYNTPIFAIKKKD
G~KWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEEFRKY
TAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAQNPEIIIYQYVDDL
LIGSDLEIGQHRAKVEELRGHLLKWGLTTPDKKHQKEPPFQWMGYELHPDKWTVQPIQLP
EKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010