<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-015 2-015 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14R, I15V, L19I, E35D, M36L, R41K, L63P, H69K, V82VI, I93L  
>2-015| codons 1-99
PQITLWQRPLVSIRVGGQIKEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, V60I, D121H, K122E, I135T, S162C, K173A, T200A, Q207A, V245Q, A272P, K277R, K281R, E291D, V292I, I293V, E297EK, D324E, Q334D  
>2-015| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGDG

References
Author Title Citation
Chaturbhuj, DN Transmitted HIV drug resistance among HIV-infected voluntary counseling and testing centers (VCTC) clients in Mumbai, India. ARHR, 2010