<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-015 1-015 India 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39TAEK, S48T, V60VI, K122E, D123S, K173A, D177E, I178M, T200A, Q207N, R211K, V245Q, A272P, E291D, I293V, G333E  
>1-015| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12S, L19T, N37NS, P39Q, R41K, K45R, L63P, H69K, L89M, I93L  
>1-015| codons 1-99
PQITLWQRPLVSIKIGGQTKEALLDTGADDTVFEEMSLQGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Chaturbhuj, DN Transmitted HIV drug resistance among HIV-infected voluntary counseling and testing centers (VCTC) clients in Mumbai, India. ARHR, 2010