<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MC35ZA MC35ZA South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19V, K20R, M36I, P39K, R41K, Q61H, L63Q, H69K, K70Q, L89I, I93L  
>MC35ZA| codons 1-99
PQITLWQRPLVSIKVEGQVREALLDTGADDTVLEEINLKGKWKPKMIGGIGGFIKVRQYD
HIQIEICGKQAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, D123G, K173E, Q174R, D177E, T200A, Q207E, R211K, V245Q, A272P, T286A, E291D, V292I, I293V, Q334N, G335D  
>MC35ZA| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRERNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQ

References
Author Title Citation
Nwobegahay, JM Low prevalence of transmitted genetic drug resistance in a cohort of HIV infected na´ve patients entering antiretroviral treatment programs at two sites in northern South Africa. J Med Virol, 2012