<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BBVCT57ZA BBVCT57ZA South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35D, M36I, R41K, R57K, L63I, H69K, A71T, I72V, I93L  
>BBVCT57ZA| codons 19-99
IKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIIIEICGKKTVGTVLVG
PTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Nwobegahay, JM Prevalence of drug-resistant mutations in newly diagnosed drug-naive HIV-1-infected individuals in a treatment site in the Waterberg district, Limpopo province. S Afr Med J, 2011