<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BBVCT05ZA BBVCT05ZA South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, I15V, L19I, M36I, R41K, L63S, H69K, K70R, I72T, I93L  
>BBVCT05ZA| codons 1-98
PQITLWQRPIVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRATGTVLVGPTPVNIIGRNLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, S48T, V60I, K122E, D123N, T165I, K173A, D177E, T200A, Q207E, V245Q, S251N, A272R, R284K, T286A, E291D, V292I, I293V, D324E, Q334N, G335D, R356K, M357R, G359T, T369A  
>BBVCT05ZA| codons 1-375
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDNWTVNDIQKLVGKLNWASQIYRGIKVKQLCKLLKGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLAEAVQKI

References
Author Title Citation
Nwobegahay, JM Prevalence of drug-resistant mutations in newly diagnosed drug-naive HIV-1-infected individuals in a treatment site in the Waterberg district, Limpopo province. S Afr Med J, 2011