<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BBVCT15ZA BBVCT15ZA South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, R41K, R57K, L63S, H69K, I93L D60G
>BBVCT15ZA| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVKQYG
QISIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, T39E, S48T, K82R, A98S, K122E, I135K, K173A, Q174K, D177E, V179I, T200A, Q207E, R211K, V245Q, D250E, S251D, A272P, L283I, V292I, I293V W71S, R72G, L193I
>BBVCT15ZA| codons 1-322
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKSGKLVDFRELNRRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
CQYMDDLYVGSDIEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKEDWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPS

References
Author Title Citation
Nwobegahay, JM Prevalence of drug-resistant mutations in newly diagnosed drug-naive HIV-1-infected individuals in a treatment site in the Waterberg district, Limpopo province. S Afr Med J, 2011