<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MV-148 MV-148wk16 U.K. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       S162A, K166KR, Q174H, I178M, R199RK, E203EK, R206RK, Q207H, R211K  
>MV-148wk16| codons 30-219
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQASMTRILEPFRKHNPDMVIYQYVDDLYVGSDLEIGQHKTKIKELKHHL
LKWGFTTPDK

References
Author Title Citation
Miller, V HIV-1 reverse transcriptase (RT) genotype and susceptibility to RT inhibitors during abacavir monotherapy and combination therapy. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005