<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MV-140 MV-140wk16 U.K. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V       I50V, R83K, K122E, E169D, G196E, T200I, R206RK D186DN
>MV-140wk16| codons 30-219
KIKALVEICTEMEKEGKISKVGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKKTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRIKIEELKQHL
LRWGFTTPDK

References
Author Title Citation
Miller, V HIV-1 reverse transcriptase (RT) genotype and susceptibility to RT inhibitors during abacavir monotherapy and combination therapy. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005