<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MV-128 MV-128wk16 U.K. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       K32Q, A98S, K102Q, I135R, R211K  
>MV-128wk16| codons 30-219
KIQALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWE
VQLGIPHPSGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSRNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHL
LKWGFTTPDK

References
Author Title Citation
Miller, V HIV-1 reverse transcriptase (RT) genotype and susceptibility to RT inhibitors during abacavir monotherapy and combination therapy. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005