<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
324350 06SP324350 Spain 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K49R, R83K, V90VI, S134SG, S162X, T165TI, E169D, G196E L120S
>06SP324350| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPSDKDFRKYTAFTIPGINNETPGIRYQYNVLPQGWKGSP
AIFQXSMIKILDPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, R41K, I62V  
>06SP324350| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQVL
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Yebra, G HIV-1 non-B subtypes: high transmitted NNRTI-resistance in Spain and impaired genotypic resistance interpretation due to variability. Antiviral Res, 2010