<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
243937 05SP0243937 Spain 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, N37D, R41K, R57RK, D60E, Q61E, I62V, L63P, E65D, A71V, V77I, I93L  
>05SP0243937| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMDLPGKWKPKMIGGIGGFIKVKQYE
EVPIDICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215L, K219Q     D123E, I135T, S162C, K173Q, D177G, G196E, I202V, R211K, V245T, A272P, T286A, V292I, E297K, I326V  
>05SP0243937| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRQQNPGIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLKWGFLTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQG

References
Author Title Citation
Yebra, G HIV-1 non-B subtypes: high transmitted NNRTI-resistance in Spain and impaired genotypic resistance interpretation due to variability. Antiviral Res, 2010