<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
249429 05SP0249429 Spain 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35VIM, E40D, V60VI, R83K, D123E, S162Y, K166KR, D177E, R211RG, L228LF, A272P, I274IV, K281KR, A288S, E297K  
>05SP0249429| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFFWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGVKVKQLCRLLRGTKSLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, D60E, V77VI  
>05SP0249429| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Yebra, G HIV-1 non-B subtypes: high transmitted NNRTI-resistance in Spain and impaired genotypic resistance interpretation due to variability. Antiviral Res, 2010