<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2697843 05SP02697843 Spain 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K20V, M36I, R41RK, R57RK, L63P, H69NS, L89M  
>05SP02697843| codons 1-99
PQITLWQRPLVTVKIGGQLVEALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGSKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IT, E36ED, V60VI, D123E, I135L, S162A, E169EAKT, K173T, Q174K, D177E, I178M, T200A, Q207E, R211RK, V245K, A272P, T286A, V292I, I293V, P294A, S322A, I326IV  
>05SP02697843| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILTPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVALTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQ

References
Author Title Citation
Yebra, G HIV-1 non-B subtypes: high transmitted NNRTI-resistance in Spain and impaired genotypic resistance interpretation due to variability. Antiviral Res, 2010