<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
296581 06SP0296581 Spain 2006 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, K14R, I15V, L19I, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, T74S, L89M  
>06SP0296581| codons 4-99
TLWQRPLVNIRVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQIT
IDICGHKATGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, K104R, D123E, I135L, S162C, K173A, Q174K, T200A, E204EK, Q207A, R211EK, V245Q  
>06SP0296581| codons 38-247
CADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRAKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEKLRAHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Yebra, G HIV-1 non-B subtypes: high transmitted NNRTI-resistance in Spain and impaired genotypic resistance interpretation due to variability. Antiviral Res, 2010