<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M8528 M8528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I15V, L19I, M36I, N37E, R57K, D60E, L63P, H69K, I85V  
>M8528| codons 1-99
PQITLWQRPIVTIKVGGQIKEALLDTGADDTVLEEIELPGRWKPKMIGGIGGFIKVKQYE
QIPIEICGKKAIGTVLVGPTPVNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V10I, T27S, A98S, D121Y, K122E, F171Y, D177G, V179I, T200A, R211K, V245E, E248D, A272P, K277R, L283I, V292I, E297K, Q334H, K366R, K390R, A400S, E404D, V435A, G436E, D460S, Q480K, H483Y  
>M8528| codons 1-494
PISPIETVPIKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPGIII
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFRLPIQKETWESWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAEAETFYVDGAANRETKLGKAGYVTSRGRQKVVSLTDTTNQKTELK
AIYLALQDSGLEVN

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009