<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G8500 G8500 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   E35G, M36I, I62V, L63P  
>G8500| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215S Y181C V179D, Y318F S68G, K103R, K122E, D123S, I135V, S162C, R211K, H221Y, V245E, E248EK, A272S, I293V, H315Y, M357V, T377TI, T386I, E399D, A400T, V435A, E449G, K454R, T470P, K512Q, S519N, K527N  
>G8500| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFSTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPKKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVYGVFYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQLTEAVQKIAIESIVIWGKIPKFKLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRGTKLGRAGYVTDRGRQKVVSLPDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009