<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G3542 G3542 U.S. 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12IKM, G16GE, E35D, M36L, N37E, R41K, R57K, I62V, L63T, I64V, H69Y  
>G3542| codons 1-99
PQITLWQRPLVMIKIEGQLKEALLDTGADDTVLEDLELPGKWKPKMIGGIGGFIKVKQYD
QVTVEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188YC   K20R, V35IT, T39TA, S68SG, T69TN, K122E, I135V, I142L, Y144YF, K166R, I202V, R211K, F214L, V245M, K277R, T286A, I293V, E297K, A304E, E312N, I329V, G333AE, Q334QH, G335GD, R356K, M357A, G359S, T362TN, T369S, T377L, A400T, V435A, A437V, H483Y, Q507H, A554T V111VG
>G3542| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDGGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGLRFQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLCVGSDLEIGQHRTKVEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELEENREILKNPVHGVYYDPSKDLIAEVQKQEHDQWTYQIYQEPFKNLKTGKYAKARSA
HNNDVKQLSEAVQKIALESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIHAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, E13D, L101I, I113V, T124A, I220L K186K*
>G3542| codons 1-288
FLDGIDKAQEDHDKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTVHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNF*RKGGIGGYSAGERIVDIIATDIQTKELQKQITKLQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009