<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
A2508 A2508 U.S. 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, Q18L, M36I, I62V, L63P, A71V, I93L  
>A2508| codons 1-99
PQITLWQRPLVTVKIGGLLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K70KN     K49R, S162C, Q174H, V179VG, T200A, E204X, Q207E, R211K, T286A, K311R, P313Q, D324E, G333E, Q334R, G335E, G359S, T377M, T386I, T403R, N447NS, T450NS, L452I, L491S, S519N, V531I E79EK
>A2508| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTNWRKLVDFRKLNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKHNPDIGI
YQYMDDLYVGSDLEIGQHRAKIEVLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILREQVHGVYYDPSKELIAEIQKQEREQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIAMESIVIWGKIPKFKLPIQKETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAASRESKIGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKIYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009