<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
INT_3807 INT_3807 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14KR, R20RK, S24SG, D25E, V31VI, V32VI, S39C, I72V, K111KR, S119P, G193E, V201I, T206S, I208IL, T210TI, K211R, E212EA D279GS, S283SG
>INT_3807| codons 1-288
FLDGIDKAQEDHERYHSNWKAMAGEFNLPPIIAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVRTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIASDLQIRALQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDSCVAGRQDED

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009