<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
INT_3655 INT_3655 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I S17N, L28I, G59GE, I72V, V77VA, P90PA, L101I, I113IL, T122I, T124N, E157EK, A265AV  
>INT_3655| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNIPPVVAKEIVASCDKCQLKGEAMHGQVDCSPEI
WQLDCTHLEGKVILVAAHVASGYIEAEVIAAETGQETAYFILKLAGRWPVKTLHTDNGSN
FISNTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKKLKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Brumme, ZL HLA-associated immune escape pathways in HIV-1 subtype B gag, pol and nef proteins. PLoS Med, 2009