<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SIIDC0292 SIIDC0292 Sweden 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35T, T39A, E40D, K49R, D123E, I135T, S162C, F171Y, D177DN, G196E, I202V, R211G P176AITV
>SIIDC0292| codons 1-226
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRKQNVNIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLGWGFTTPDKKHQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37Q, R57K, L63S, I64M, A71V, V77I, I93L  
>SIIDC0292| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMQLPGRWKPKMIGGIGGFIKVKQYD
QISMEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Lindstrom, A HIV-1 transmission cluster with M41L 'singleton' mutation and decreased transmission of resistance in newly diagnosed Swedish homosexual men. Antivir Ther, 2006