<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SIIDC0282 SIIDC0282 Sweden 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, G17E, K20R, E35D, M36I, R41K, H69K, I72V, L89M, I93L  
>SIIDC0282| codons 1-99
PQITLWQRPLVTVKIGEQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K122E, D123S, I135M, S162SC, K173IR, Q174K, D177E, I178V, G196E, Q207A, R211S, K238R, V245E  
>SIIDC0282| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEVVI
YQYMDDLYVGSDLEIEQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWT

References
Author Title Citation
Lindstrom, A HIV-1 transmission cluster with M41L 'singleton' mutation and decreased transmission of resistance in newly diagnosed Swedish homosexual men. Antivir Ther, 2006