<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KECst_008 KECst_008 Kenya 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, R41K, Q61N, L63T, G68E, H69K, K70R, L89M, T91V, I93L M36F
>KECst_008| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDFNLPGKWKPKMIGGIGGFIKVRQYD
NITIEICEKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, K122E, D123S, I135T, K173A, D177E, I178M, T200A, Q207E, R211K, A272S, K277R, L282C, L283I, T286A, I293V, P294A, I329L, G335D, P345Q, F346Y, R356K, M357S, A360T, T377Q, S379C, K390R, A400T, V435E, V467I, L469I, T470A, H483N, L503I, Q509T, Q524E, A534S, A554N  
>KECst_008| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKCIRGAKALTEVVALTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQDQWTYQIYQEQYKNLKTGKYAKSRGT
HTNDVKQLTEAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTDRGRQKVISIADTTNQKTELQ
AINLALQDSGLEVNIVTDSQYAIGIIQATPDKSESELVSQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, L101I, T112V, S119P, T122I, T125Q, I135V, V201I, I208L, K211Q, L234I S283G
>KECst_008| codons 1-288
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FISTQVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDLQTQELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Tovanabutra, S Evaluation of HIV type 1 strains in men having sex with men and in female sex workers in Mombasa, Kenya. ARHR, 2010