<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KECst_027 KECst_027 Kenya 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, G16E, M36I, R41K, Q61E, L63V, G68E, H69K, K70R, L89M, T91V  
>KECst_027| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
EIVIEICEKRAIGTVLVGPTPVNIIGRNMLVQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V8I, V35T, T39N, S48T, D121C, K122E, I142V, K166Q, D177E, T200A, Q207E, R211K, V245E, K281R, E291D, V292I, I293V, E297K, A304E, E312D, G335D, R356K, M357R, G359S, A360T, A376T, T377L, S379C, K390R, A400T, Y405H, E432D, V435I, R461K, V466I, V467I, D471E, Q480H, L491S, K512Q, S519N, Q520K, Q524K, K527E, E529D, A554S, K558R Y56D
>KECst_027| codons 1-560
PISPIKTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKITKIGPENPDNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTQILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDIVPLTKEAE
LELEENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRST
HTNDVKQLTEAVQKITLECIVIWGKTPKFRLPIQKETWETWWTEHWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDKGRQKIISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDQSESELVNKIIEKLIEKDKVYLAWVPAHK
GIGGNEQVDKLVSSGIRRVL

References
Author Title Citation
Tovanabutra, S Evaluation of HIV type 1 strains in men having sex with men and in female sex workers in Mombasa, Kenya. ARHR, 2010