<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 49
2 EFV+FTC+TDF 18
3 FTC+LPV+TDF 35
4 None 39
5 ATV+FTC+RTV+TDF 9
6 None 9
7 FTC+MVC+RAL+TDF 86

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, K34R, I72V, T124A, V201I, T206S, T218S, D270E  
>CA153557| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAREIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQISKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIREYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L63P  
>CA152335| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K122E, D123DG, I135IT, I142V, T165I, D177E, T200E, R211K, V245E, E248D, K281R, T286A, A288G, P294T, E297K  
>CA152336| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHREKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKGLTEVITLTKEAE
L

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011