<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L68I S17N, V32I, I73V, L101I, K103R, K111R, S119T, M154I, V165I, V201I, A205S, T210I, K211R, T218I, L234V, D256E S283G, D286N
>EI024| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHIEGKIVLVAVHVASGYIEAEVIPAETGQETAYFILRLAGRWPVRTIHTDNGTN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESINKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQIRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQNED

References
Author Title Citation
Arruda, LB Genetic diversity on the integrase region of the pol gene among HIV type 1-infected patients naive for integrase inhibitors in Sao Paulo City, Brazil. ARHR, 2010