<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID2137 ID2137-GT1 Germany 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 IDV|LPV|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47A, V82A   L10I, T12S, I15V, K20R, M36I, R41K, L63P, H69K, A71V, I85V, I93L L19AP
>ID2137-GT1| codons 1-99
PQITLWQRPIVSIKVGGQPREALLDTGADDTILEEINLPGKWKPKMAGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPANIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219E Y181C   I2V, K32E, V35T, E36A, T39E, V90I, K122P, I135M, T139K, I142V, S162N, K173A, Q174K, V179I, I195L, G196E, Q197H, T200A, I202V, E203K, Q207E, L228H, V245K, A272P, L283I, T286V, E291D, V292I, I293V, D324E K20T, E28T
>ID2137-GT1| codons 1-333
PVSPIETVPVKLKPGMDGPTVKQWPLTTEKIEALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSMNNEKPGVRYQYNVLPQGWKGSPAIFQNSMTKILEPFRAKNPDIII
CQYMDDLYVGSDLELEHHRAKVKELREHLLRWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGVKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010