<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID2117 ID2117-GT2 Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 LPV + RTI 209

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L76LV   T12P, I13V, K14R, G16E, K20KT, E35D, L63A, I64V, E65D  
>ID2117-GT2| codons 1-99
PQITLWQRPLVPVRIEGQLTEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIAVDICGHKAIGTVVVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D V60I, V118I, K122Q, D123N, I135IT, I142IT, Q174QK, Q207QE, F214L, A272P, K277R, T286A, I293V, E297EK E302A
>ID2117-GT2| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DQNFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIDI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LAL

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010