<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID1585 ID1585-GT1 Germany 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 APV|RTV|SQV|NFV|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82M, I84V, L90M L33F, Q58E L10V, T12V, I13IV, K14KR, I15V, K20R, E35D, M36I, N37E, R41K, R57K, L63P, H69K, L89I  
>ID1585-GT1| codons 1-99
PQITLWQRPVVVVRVGGQLREALLDTGADDTVFEDIELPGKWKPKMIGGIGGFVKVKEYD
QIPIEICGKKAIGTVLVGPTPMNVIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LV, M184V, L210W, T215F K219Q K103KN, Y181YC A98G V35T, T39E, K122E, D123DN, K173T, Q174K, G196E, I202V, E203K, Q207E, R211RK, L228H, V245Q, E248D, D250E, T286A, E291D, V292I, I293V, E297A  
>ID1585-GT1| codons 1-323
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
CQYVDDLYVGSDLEIEQHRTKVKELREHLWKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSK

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010