<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID1348 ID1348-GT2 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV | RTI NA
2 ABC+APV+RTV+TDF 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, L76LV L24I L10I, I15IV, N37D, I62V, L63P, I64V, V82VI, Q92R  
>ID1348-GT2| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMDLPGRWKPKIVGGIGGFIKVRQYD
QVPVEICGHKAIGTVVVGPTPINIIGRNLLTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV, T215FI K219Q K101PS, K103NS   K11T, V60VI, T69N, K122KE, D123N, I142V, R211RS, F214L, L228H, V245T, K277R, T286A, I293IV, E297KR, Q334L  
>ID1348-GT2| codons 1-335
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLSKSKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLSWGLITPDQKHQKEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010