<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID1318 ID1318-GT1 Germany 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 APV|IDV|NFV|SQV|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M V11VI, G73S L10LI, T12TA, I15V, L19Q, K20I, E35D, M36I, D60DE, I62V, L63P, A71V, I93L  
>ID1318-GT1| codons 1-99
PQITLWQRPIIAIKVGGQQIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V F116Y L100LI V179D S68G, T69TN, K103R, D123E, I135T, T200A, Q207H, R211K, A272P, T286A, E312AT, S322SL  
>ID1318-GT1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKRKSVTVLDVGDAYYSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRAKIEELRHHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKTPVHGVYYDPLKD

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010