<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID1083 ID1083-GT1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV|NFV|SQV|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, I13V, L63P, A71V, V77I, I93L  
>ID1083-GT1| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184V, L210W, T215Y K219N K103N A98G, V108I, F227L V35I, K43Q, E53D, K102KQ, V118I, K122E, I135V, S162C, E203K, H208Y, R211K, K223E, A272P, K277R  
>ID1083-GT1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPDNPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKQNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTPDNKHQEEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010