<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID1046 ID1046-GT2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 APV|IDV|SQV|RTI NA
2 3TC+D4T+LPV 38

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M   L10I, G16A, K20R, E34Q, E35D, M36I, N37D, K55R, R57K, D60E, Q61EK, I62V, L63P, A71V, I72T, I85V, I93L  
>ID1046-GT2| codons 1-99
PQITLWQRPIVTIKIAGQLREALLDTGADDTVLQDIDLPGRWKPKIIGGIGGFVRVKQYE
KVPIEICGHKVTGTVVVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, M184V, L210W, T215Y A62V, V75I, F116Y G190A   V106VI, K122E, D123E, S162Y, D177E, E203K, H208Y, R211D, K223E, E224ED, L228LH, V245T, A272S, K277R, T286A, A288T  
>ID1046-GT2| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYYSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYVDDLYVASDLEIGQHRTKIKELRQYLWDWGFYTPDKKHQEDPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGAKTLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010