<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID0462 ID0462-GT2 Germany 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 LPV + RTI NA
2 3TC+ABC+LPV 105

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V   L10V, T12K, I13V, K14R, G16E, L19I, K20I, M36I, R41K, H69K, L89M  
>ID0462-GT2| codons 1-99
PQITLWQRPVVKVRIEGQIIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKKAIGTVVVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36D, E40EK, K43E, K49R, K122E, D123S, S162A, K166R, K173I, Q174K, D177E, V179I, T200A, Q207E, V245Q, K277R, T286A, E291D, V292I, I293V, S322A, I326V  
>ID0462-GT2| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTKMEEEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTRILEPFRIKNPEIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQ

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010