<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ID0237 ID0237-GT2 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 ABC + DDI + LPV 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L76V, V82F, L90M L23I, L33F, Q58E L10I, I13V, M36L, K55KR, I62V, I64V  
>ID0237-GT2| codons 1-99
PQITLWQRPIVTVKIGGQLKEAILDTGADDTVFEELNLPGRWKPKLIGGIGGFIRVREYD
QVLVEICGHKAIGTVVVGPTPFNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69E_KREKTSE, L210W, T215Y V75VIL     K20KR, V35L, T39A, K43E, E44A, V118I, K122E, S162C, I178M, Q207E, R211K, V245E, A272P  
>ID0237-GT2| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSEKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Knops, E The evolution of protease mutation 76V is associated with protease mutation 46I and gag mutation 431V. AIDS, 2010