<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
07V1ZA 07V1ZA South Africa 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D E6D, K20R, V35T, E36A, T39E, S48T, V60I, V118I, K122E, D123N, E138A, K173M, Q174K, Q197L, T200A, Q207D, F214L, V245Q, E248D, S251V, A272P, T286A, E291D, V292I, I293V E203N
>07V1ZA| codons 1-300
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMKNPDIDI
YQYMDDLYVGSDLEIGLHRAKINELRDHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDVWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, D60E, L63P, H69K, L89M, I93L  
>07V1ZA| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Iweriebor, BC Molecular epidemiology of HIV in two highly endemic areas of northeastern South Africa. Arch Virol, 2012