<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
06178 CNsd06178 China 2006 HIV1 CRF01_AE Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39D, K122E, D123S, I135T, S162C, K173I, Q174K, D177E, I178M, Q207S, L210F, R211S, K238R, V245E, E248D  
>CNsd06178| codons 1-251
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLFSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPDKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, H69K, L89M  
>CNsd06178| codons 13-99
VKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Zhang, J Surveillance of transmitted HIV type 1 drug resistance in newly diagnosed HIV type 1-infected patients in Shandong province, China. ARHR, 2010