<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
0616 CNsd0616 China 2006 HIV1 C Dried Blood Spot None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, L19V, M36I, R41K, L63S, H69K, K70R, L89M, I93L  
>CNsd0616| codons 13-99
IRIGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQISIEICGKRAI
GTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11R, V35T, T39D, S48T, V60I, K122E, D123N, T165I, K173I, Q174K, D177E, G196E, I202V, Q207A, R211S, K238R, V245Q  
>CNsd0616| codons 1-251
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIEQHRTKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIQLPEKDS

References
Author Title Citation
Zhang, J Surveillance of transmitted HIV type 1 drug resistance in newly diagnosed HIV type 1-infected patients in Shandong province, China. ARHR, 2010