<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 5_M9 France 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RAL 39

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140S, Q148H L74LM E11D, E13D, V31I, K34KR, M50I, S57G, L63I, S119P, T122I, T124A, T206S, I208IL, S255N, D256E S283G
>5_M9| codons 1-288
FLDGIDKAQEDHDKYHSNWRAMASDFNLPPIVAREIVASCDKCQLKGEAIHGQVDCGPGI
WQIDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGPN
FISATVKAACWWAGIKQEFSIPYNPQSHGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Wittkop, L Virological and immunological response in HIV-1-infected patients with multiple treatment failures receiving raltegravir and optimized background therapy, ANRS CO3 Aquitaine Cohort. J Antimicrob Chemother, 2009