<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 7_M9 France 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RAL 39

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
Y143YCHR T97TA, G163GR S17N, I72V, L101I, G106GA, S119G, T122I, T125A, S195SN, A196AT, T218TS, I220L, Y227F A169FS, F185FL
>7_M9| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFILKLAARWPVKTIHTDNGGN
FISTAVKAACWWAGIKQEFGIPRNPQSQGVVESMNKELKKIIRQVRDQSEHLKTAVQMAV
FIHNLKRKGGIGGYNTGERIVDIIATDIQTKELQKQISKLQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
da Silva, D HIV-1 resistance patterns to integrase inhibitors in antiretroviral-experienced patients with virological failure on raltegravir-containing regimens. J Antimicrob Chemother, 2010
Wittkop, L Virological and immunological response in HIV-1-infected patients with multiple treatment failures receiving raltegravir and optimized background therapy, ANRS CO3 Aquitaine Cohort. J Antimicrob Chemother, 2009