<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI+PI NA
2 ABC+DRV+ETR+RAL+RTV 16

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
Y143R   I113V, T124NS, T125A, T206S, I220L, Y227F  
>Pt3| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSNAVKAACWWAGIKQEFGIPRNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKLQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Delelis, O Impact of Y143 HIV-1 integrase mutations on resistance to raltegravir in vitro and in vivo. AAC, 2009