<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
06LPH19CM 06LPH19CM Cameroon 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11V, V35T, E40D, K102Q, V118I, K122E, D123N, I135T, T139L, S162A, K173S, V179I L12S
>06LPH19CM| codons 1-197
PISPIKTVPVVSKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNELPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSQNPDIII
YQYMDDLYVGSDLEIGQ

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010