<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
06LPH17HT 06LPH17HT Cameroon 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A   E6K, V35T, E36D, T39A, K104R, K122E, I135V, I142V, S162A, T165I, K173T, Q174K, D177E, I178M  
>06LPH17HT| codons 1-197
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEMVI
YQYMDDLYVASDLEIGQ

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010