<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
07BDHS077 07BDHS077 Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215Y K219E V106A P225H, F227L V35T, L109I, K122E, I135V, S162A, K173I, Q174K, D177E, T200A, I202V, R211K, A272P, K275R, K277R, T286A, I293V, P294T, S322V, G335D, M357K, G359S, A371V, I375V, I382L, K390R, A400T, T403Q, E432D, V435E, A437V R78P
>07BDHS077| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFPELNKRTQDFWEVQLGIPHPAGLKKKKSATVIDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRQHLLKWGFYTPDEKHQKEHPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPVKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVKQLTEVVQKVATESIVLWGKTPKFRLPIQKETWETWWQEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIEGVETF

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010