<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
07LPH142 07LPH142 Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   Y181C   V35P, E36D, T39L, K49R, S68G, A98S, I135V, S162T, F171Y, K173T, Q174R, D177E, I178M, T200A, Q207E, R211K, H221X, P243H, V245Q, T286A, E291D, V292I, I293V, P294T, S322A, I326V, R356K, M357K, G359S, A371V, I375V, K390R, A400T, T403M, E413D, E432D, V435I  
>07LPH142| codons 1-440
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALPDICLEMEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPYRTRNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKXQKEPPFLWMGYELHPDKWT
VQHIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPDWEFVNTP
PLVKLWYQLEKDPIIGAETF

References
Author Title Citation
Burda, ST HIV-1 reverse transcriptase drug-resistance mutations in chronically infected individuals receiving or naive to HAART in Cameroon. J Med Virol, 2010